PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5AL_56F30392D.1
Common NameMyb1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 156aa    MW: 17842.3 Da    PI: 10.1935
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5AL_56F30392D.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding537.9e-171461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+eEd++l  ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Traes_5AL_56F30392D.1 14 KGAWTKEEDDRLTAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                           79******************************99************97 PP

2Myb_DNA-binding58.71.3e-1867111147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rg+++ eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++
  Traes_5AL_56F30392D.1  67 RGNFSDEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                            89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.8E-24564IPR009057Homeodomain-like
PROSITE profilePS5129415.407961IPR017930Myb domain
SuperFamilySSF466892.17E-2913108IPR009057Homeodomain-like
SMARTSM007176.3E-131363IPR001005SANT/Myb domain
PfamPF002491.2E-141461IPR001005SANT/Myb domain
CDDcd001671.17E-91661No hitNo description
PROSITE profilePS5129428.57562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-2865116IPR009057Homeodomain-like
SMARTSM007173.3E-1766114IPR001005SANT/Myb domain
PfamPF002491.0E-1667111IPR001005SANT/Myb domain
CDDcd001674.66E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDDRLTAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF SDEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIRRKLTSRG  120
IDPVTHRAIN SDHAASNITI SFETAQRDDK GAVFRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-291311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6151980.0AY615198.1 Triticum aestivum transcription factor Myb1 (Myb1) mRNA, complete cds.
GenBankBT0090840.0BT009084.1 Triticum aestivum clone wkm1c.pk005.f4:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957488.15e-97PREDICTED: myb-related protein Hv1
SwissprotP200261e-113MYB1_HORVU; Myb-related protein Hv1
TrEMBLM7ZNU31e-112M7ZNU3_TRIUA; Myb-related protein Hv1
TrEMBLQ6IX781e-112Q6IX78_WHEAT; Transcription factor Myb1
TrEMBLW5EXB11e-113W5EXB1_WHEAT; Uncharacterized protein
STRINGSi030943m2e-96(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.13e-91myb domain protein 4